LC-MS/MS Quantitation of HILIC-Enriched N-glycopeptides Derived from Low-Abundance Serum Glycoproteins in Patients with Narcolepsy Type 1

Abstract

Glycoproteomic analysis is always challenging because of low abundance and complex site-specific heterogeneity. Glycoproteins are involved in various biological processes such as cell signaling, adhesion, and cell–cell communication and may serve as potential biomarkers when analyzing different diseases. Here, we investigate glycoproteins in narcolepsy type 1 (NT1) disease, a form of narcolepsy characterized by cataplexy—the sudden onset of muscle paralysis that is typically triggered by intense emotions. In this study, 27 human blood serum samples were analyzed, 16 from NT1 patients and 11 from healthy individuals serving as controls. We quantified hydrophilic interaction liquid chromatography (HILIC)-enriched glycopeptides from low-abundance serum samples of controls and NT1 patients via LC-MS/MS. Twenty-eight unique N-glycopeptides showed significant changes between the two studied groups. The sialylated N-glycopeptide structures LPTQNITFQTESSVAEQEAEFQSPK HexNAc6, Hex3, Neu5Ac2 (derived from the ITIH4 protein) and the structure IVLDPSGSMNIYLVLDGSDSIGASNFTGAK HexNAc5, Hex4, Fuc1 (derived from the CFB protein), with p values of 0.008 and 0.01, respectively, were elevated in NT1 samples compared with controls. In addition, the N-glycopeptide protein sources Ceruloplasmin, Complement factor B, and ITH4 were observed to play an important role in the complement activation and acute-phase response signaling pathways. This may explain the possible association between the biomarkers and pathophysiological effects. © 2023 by the authors.

Description

Keywords

Biomarker glycoproteins, Hilic-enriched n-glycopeptides, Nt1, Biomarkers, Chromatography, liquid, Glycopeptides, Glycoproteins, Glycosylation, Humans, Hydrophobic and hydrophilic interactions, Narcolepsy, Serum, Tandem mass spectrometry, Alternative complement pathway c3 c5 convertase, Angiotensinogen, Biological marker, Blood clotting factor, Ceruloplasmin, Coagulation factor 13 beta chain, Fucose, Galactose, Glucose, Glycopeptide, Glycoprotein, Hemopexin, Inter alpha trypsin inhibitor heavy chain h4, Mannose, N acetylglucosamine, N acetylneuraminic acid, N glycopeptide, Prothrombin, Unclassified drug, Adult, Aged, Article, Bicinchoninic acid assay, Controlled study, Diagnostic test accuracy study, Down regulation, Female, Human, Hydrophilic interaction chromatography, Investigative procedures, Liquid chromatography-mass spectrometry, Male, Narcolepsy with cataplexy, Parallel reaction monitoring, Receiver operating characteristic, Upregulation, Chemical phenomena, Chemistry, Liquid chromatography, Procedures

Citation

Endorsement

Review

Supplemented By

Referenced By